PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN44615.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family WOX
Protein Properties Length: 357aa    MW: 40518.3 Da    PI: 7.3472
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN44615.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox702.8e-2281140357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  KHN44615.1  81 SRWNPTPEQLRALEELYRRgTRTPSAEQIQHITAQLrrfgNIEGKNVFYWFQNHKARERQ 140
                 7*****************99**************************************97 PP

2Wus_type_Homeobox112.91.7e-3680142365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++G+ie+kNVfyWFQN+kaRerqk+
         KHN44615.1  80 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQHITAQLRRFGNIEGKNVFYWFQNHKARERQKR 142
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003896.1E-578145IPR001356Homeobox domain
SuperFamilySSF466893.46E-1281146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-981140IPR009057Homeodomain-like
PfamPF000465.5E-2081140IPR001356Homeobox domain
CDDcd000864.18E-782142No hitNo description
PROSITE profilePS5007111.45186141IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MWMMGYEGGE FNMVEHSLIT GRKLKPLMPR PMTTSLNNAP TTTTPSLSQI HGNDFLSQYH  60
YHHLEQNKRE FNGAAPVVVS SRWNPTPEQL RALEELYRRG TRTPSAEQIQ HITAQLRRFG  120
NIEGKNVFYW FQNHKARERQ KRRRQMESDA ETPEKKDLAA SRTVFEVERT KNWTPSTNCS  180
TIAEESVSTQ RTAKAVAAES RTDGWLLLDE GELQQRRNVF ERNARWHVMQ LPCPSPSSAP  240
VTHLINTPPN ASVASSMATT TTTVTTRKMD PNLIKTHDLS FFISPQRENS AIYFSGSSST  300
SEEDNCVESQ TLQLFPLRSG DGISDNMKDN ETEISASAMN ANNLTPGQFF EFLPMKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0984090.0BT098409.1 Soybean clone JCVI-FLGm-16H23 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583454.10.0PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A0B2SHU40.0A0A0B2SHU4_GLYSO; WUSCHEL-related homeobox 1
TrEMBLK7L0T10.0K7L0T1_SOYBN; Uncharacterized protein
STRINGGLYMA07G11372.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.11e-52WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]